![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.3KG314300.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 141aa MW: 15416.2 Da PI: 4.9152 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 173.1 | 3e-54 | 18 | 114 | 2 | 98 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 +eqdr+lPian++rim++++P+n+ki+kdake+vqecvsefisf+tseasdkc +ekrkting+dl+w+++tlGfe+yveplk ylk yr Pavir.3KG314300.1.p 18 KEQDRYLPIANIGRIMRRAVPENGKIAKDAKESVQECVSEFISFITSEASDKCMKEKRKTINGEDLIWSMGTLGFEEYVEPLKHYLKLYR 107 89**************************************************************************************** PP NF-YB 92 elegekk 98 e+eg++k Pavir.3KG314300.1.p 108 ETEGDTK 114 ****975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.0E-50 | 16 | 123 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.11E-38 | 20 | 120 | IPR009072 | Histone-fold |
Pfam | PF00808 | 8.6E-27 | 23 | 87 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.2E-20 | 51 | 69 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 54 | 70 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.2E-20 | 70 | 88 | No hit | No description |
PRINTS | PR00615 | 6.2E-20 | 89 | 107 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MSEAESAPET GGGSYGGKEQ DRYLPIANIG RIMRRAVPEN GKIAKDAKES VQECVSEFIS 60 FITSEASDKC MKEKRKTING EDLIWSMGTL GFEEYVEPLK HYLKLYRETE GDTKGSKSSD 120 HTGKKEIVLN GEPGSSFDGV * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 6e-47 | 18 | 108 | 3 | 93 | NF-YB |
4awl_B | 6e-47 | 18 | 108 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 6e-47 | 18 | 108 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.19264 | 0.0 | stem |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP101633 | 1e-128 | FP101633.1 Phyllostachys edulis cDNA clone: bphyst004h13, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012699849.1 | 1e-78 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | Q65XK1 | 1e-76 | NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A0A9PIF8 | 6e-83 | A0A0A9PIF8_ARUDO; Uncharacterized protein | ||||
STRING | Si024597m | 3e-74 | (Setaria italica) | ||||
STRING | Sb09g029140.1 | 2e-74 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.3 | 3e-60 | nuclear factor Y, subunit B1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.3KG314300.1.p |